{
"model": "esmfold2-2026-05-cutoff-2025",
"all_atom_input": {
"sequences": [
{
"id": "A",
"type": "protein",
"sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ"
}
]
},
"include_pae": true
}Batch API
fold_max_accuracy
Run maximum-accuracy structure prediction.
Use Batch Submit with
endpoint: "fold_max_accuracy" and one or more inputs in payload.
Each item must name esmfold2-2026-05-cutoff-2025 as its model.
This operation is available on Biohub’s Batch API.
The schema below describes one payload entry. See the Batch API overview for submission, polling, and downloads.
Inputs and limits
Supply a molecular complex throughall_atom_input with protein, RNA, DNA, or ligand entries.
The total input length is limited to 4096 tokens.
Protein residues and RNA/DNA nucleotides count as one token each; ligands and modified residues count by heavy atom.
The service generates its own MSA by searching UniRef30 and ColabFold with the following settings:
max_prefilter= 100,000max_accept= 10,000diff= 3,000expand_diff= 3,000
include_pae, include_pair_chains_iptm, and include_embeddings.One maximum-accuracy folding input. The service generates its own MSA; caller-supplied MSAs and folding recipe parameters are not supported.
The model served by fold_max_accuracy. Required in every payload item.
Available options:
esmfold2-2026-05-cutoff-2025 (ESMFold2) All atom input (protein, RNA, DNA, and ligand) to fold.
Show child attributes
Show child attributes
Disclose potential sequences of concern. For approved users, such sequences will not go through additional safety filtering. Reach out if you are interested in using this.
(ESMFold2) Whether to include Predicted Aligned Error (PAE) matrix in the response.
(ESMFold2) Whether to include pair-chain IPTM predictions in the response.
(ESMFold2) Whether to include sequence and pair embeddings in the response.